PDB entry 5lwx

View 5lwx on RCSB PDB site
Description: crystal structure of the h253d mutant of mcog from aspergillus niger
Deposited on 2016-09-19, released 2017-05-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multicopper oxidase
    Species: Aspergillus niger [TaxId:5061]
    Gene: An08g08450
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2QS62 (Start-576)
      • engineered mutation (252)
  • Heterogens: CU, NAG, BMA, MAN, PER, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lwxA (A:)
    spirhvtphlshstpiprdmqgnssqspntpwqgydintnyyetipqtnvvreywfdivn
    ttaaldgverpvllvngqfpgptieanwgdtvkvhvtnrmenngtaihfhgirqlynnqm
    dgvaaltqcpvppnssytyvwraeeygsswyhshfslqawegvfggilihgpstaeydhd
    lgmvflndwshqtvdemyqsvlesqnpphfqtglingsniwvtadnqtvgrrfqtefvpg
    qryrlrlvnaamdthfrfsidnhdltviasdfvpivpfttnnvpigmgqrydiivtanqa
    pdnywiraipqsfcsdnansdnikgvlhyegaadnsdptstkwdygddiqcldfsldelv
    pwlaldadiggaqmaesdvdftpfgdvplylwtmggnalniswkdptlqqtfedpdkmdw
    kasqgvieaaipnkwtvlvvqtdlpvphpihlhghdfyllaqgfgqfnpqnvtlkthnpp
    rrdtalmtaatpenggggymvigfpadnpgvwlihchigfhategfaqqiverqsefntf
    fsedllentcdawdeyakvnpyghqyralagpyesgi
    

    Sequence, based on observed residues (ATOM records):
    >5lwxA (A:)
    ssqspntpwqgydintnyyetipqtnvvreywfdivnttaaldgverpvllvngqfpgpt
    ieanwgdtvkvhvtnrmenngtaihfhgirqlynnqmdgvaaltqcpvppnssytyvwra
    eeygsswyhshfslqawegvfggilihgpstaeydhdlgmvflndwshqtvdemyqsvle
    sqnpphfqtglingsniwvtadnqtvgrrfqtefvpgqryrlrlvnaamdthfrfsidnh
    dltviasdfvpivpfttnnvpigmgqrydiivtanqapdnywiraipqsfcsdnansdni
    kgvlhyegaadnsdptstkwdygddiqcldfsldelvpwlaldadiggaqmaesdvdftp
    fgdvplylwtmggnalniswkdptlqqtfedpdkmdwkasqgvieaaipnkwtvlvvqtd
    lpvphpihlhghdfyllaqgfgqfnpqnvtlkthnpprrdtalmtaatpenggggymvig
    fpadnpgvwlihchigfhategfaqqiverqsefntffsedllentcdawdeyakvnpyg
    hqyralagpyesgi