PDB entry 5lwo

View 5lwo on RCSB PDB site
Description: Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K
Class: hydrolase
Keywords: nitroxide, spin label, t4 lysozyme, electron paramagnetic resonance, epr, hydrolase
Deposited on 2016-09-18, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endolysin
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered mutation (11)
      • engineered mutation (53)
      • engineered mutation (96)
      • engineered mutation (114)
      • engineered mutation (118)
      • engineered mutation (136)
    Domains in SCOPe 2.07: d5lwoa_
  • Heterogens: RXR, CL, HED, PO4, BME, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lwoA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslcm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl