PDB entry 5lwk

View 5lwk on RCSB PDB site
Description: MaeR response regulator bound to beryllium trifluoride
Class: transcription
Keywords: Response regulator Beryllium trifluoride Catalytic aspartic acid, Transcription
Deposited on 2016-09-18, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional regulatory protein
  Species: Lactobacillus paracasei [TaxId:1597]
  Gene: LPL9_2999
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0K1MY03 (0-121)
  Domains in SCOPe 2.07: d5lwka_
• Chain 'B':
  Compound: transcriptional regulatory protein
  Species: Lactobacillus paracasei [TaxId:1597]
  Gene: LPL9_2999
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0K1MY03 (0-121)
  Domains in SCOPe 2.07: d5lwkb_
• Heterogens: BEF, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lwkA (A:)
  mtniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvlldirlkdg
  ngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrt
  kh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lwkB (B:)
  mtniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvlldirlkdg
  ngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrt
  kh