PDB entry 5lwc

View 5lwc on RCSB PDB site
Description: nmr solution structure of bacteriocin bacsp222 from staphylococcus pseudintermedius 222
Deposited on 2016-09-15, released 2017-10-25
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacteriocin BacSp222
    Species: Staphylococcus pseudintermedius [TaxId:283734]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lwcA (A:)
    magllrfllskgralynwakshvgkvwewlksgatyeqikewienalgwr