PDB entry 5lw9

View 5lw9 on RCSB PDB site
Description: crystal structure of human jarid1b in complex with s40563a
Deposited on 2016-09-15, released 2016-09-28
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 5B,Lysine-specific demethylase 5B
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM5B, JARID1B, PLU1, RBBP2H1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGL1 (2-75)
      • expression tag (1)
      • linker (76)
    • Uniprot Q9UGL1 (82-End)
  • Heterogens: ZN, MN, EDO, DMS, 5UJ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lw9A (A:)
    smflpppecpvfepsweefadpfafihkirpiaeqtgickvrpppdwqppfacdvdklhf
    tpriqrlneleaqtrvklggggardytlrtfgemadafksdyfnmpvhmvptelvekefw
    rlvstieedvtveygadiaskefgsgfpvrdgkiklspeeeeyldsgwnlnnmpvmeqsv
    lahitadicgmklpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpgyaaeqle
    nvmkklapelfvsqpdllhqlvtimnpntlmthevpvyrtnqcagefvitfprayhsgfn
    qgfnfaeavnfctvdwlplgrqcvehyrllhrycvfshdemickmaskadvldvvvastv
    qkdmaimiedekalretvrklgvidsermdfellpdderqcvkckttcfmsaiscsckpg
    llvclhhvkelcscppykyklryrytlddlypmmnalklraesynewalnvnealeakin
    k
    

    Sequence, based on observed residues (ATOM records):
    >5lw9A (A:)
    mflpppecpvfepsweefadpfafihkirpiaeqtgickvrpppdwqppfacdvdklhft
    priqrlneleaqtrvkardytlrtfgemadafksdyfnmpvhmvptelvekefwrlvsti
    eedvtveygadiaskefgsgfpvrdgiklspeeeeyldsgwnlnnmpvmeqsvlahitad
    icgmklpwlyvgmcfssfcwhiedhwsysinylhwgepktwygvpgyaaeqlenvmkkla
    pelfvsqpdllhqlvtimnpntlmthevpvyrtnqcagefvitfprayhsgfnqgfnfae
    avnfctvdwlplgrqcvehyrllhrycvfshdemickmaskadvldvvvastvqkdmaim
    iedekalretvrklgvidsermdfellpdderqcvkckttcfmsaiscsckpgllvclhh
    vkelcscppykyklryrytlddlypmmnalklraes