PDB entry 5lw7

View 5lw7 on RCSB PDB site
Description: s. solfataricus abce1 post-splitting state
Deposited on 2016-09-15, released 2016-11-16
The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: EM
Resolution: 17 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: ABC transporter ATP-binding protein
    Species: Pyrococcus abyssi (strain GE5 / Orsay) [TaxId:272844]
    Gene: PAB0824
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5lw7B (B:)
    mvrkmriavidydkcnpdkcghflcervcpvnrmggeaiiideenykpiiqeasctgcgi
    cvhkcpfnaisivnlpeqldedcvhrygvnafvlyrlpivkdgmvvgivgpngtgkttav
    kilagqlipnlcedndswdnvirafrgnelqnyferlkngeirpvvkpqyvdllpkavkg
    kvrellkkvdevgkfeevvkelelenvldrelhqlsggelqrvaiaaallrkahfyffde
    pssyldirqrlkvarvirrlanegkavlvvehdlavldylsdvihvvygepgvygifskp
    kgtrngineflqgylkdenvrfrpyeirftklservdveretlveyprlvkdygsfklev
    epgeirkgevigivgpngigkttfvkmlagveeptegkvewdltvaykpqyikaeyegtv
    yellskidssklnsnfyktellkplgiidlydrnvedlsggelqrvaiaatllrdadiyl
    ldepsayldveqrlavsrairhlmeknektalvvehdvlmidyvsdrlivfegepgrhgr
    alppmgmregmnrflasvgitfrrdpdsgrprankegsvkdreqkargeyyya