PDB entry 5lw6

View 5lw6 on RCSB PDB site
Description: crystal structure of a se-met substituted dictyostelium discoideum adp-ribose binding macrodomain (residues 342-563) of ddb_g0293866
Deposited on 2016-09-15, released 2016-09-28
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ddb_g0293866
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: DDB0192167
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lw6A (A:)
    mgsshhhhhhssglvprgshmasmtggnnmgagsskiigpkyrkkrltdalkerslafpf
    iststfgfniddateisanaiseylhfhekeddiklkmmveksiysdnliqsfkkhfndk
    wdkrfeiikiensnsleqfnlgcklfatestwrlkktpqnkqlyemldtgtfekvtknly
    pncgkigkvypislqnnkqlvnsilhkeygidivilvlgvnmnpnkpdafkenselakpl
    lletyhslfnaldnf
    

    Sequence, based on observed residues (ATOM records):
    >5lw6A (A:)
    skiigpkyrkkrltdalkerslafpfiststfgfniddateisanaiseylhfhekeddi
    klkmmveksiysdnliqsfkkhfndkwdkrfeiikiensnsleqfnlgcklfatestwrl
    kktpqnkqlyemldtgtfekvtknlypncgkigkvypislqnnkqlvnsilhkeygidiv
    ilvlgvnmnpnkpdafkenselakpllletyhslfnaldnf