PDB entry 5lw4

View 5lw4 on RCSB PDB site
Description: NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A
Class: oxidoreductase
Keywords: lytic polysaccharide monooxygenase, lpmo, AA10, Chitin, Cellulose, oxidoreductase
Deposited on 2016-09-15, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative chitin binding protein
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: chbB, BL00145
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lw4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lw4A (A:)
hgfiekpgsraalcseafgflnlncgsvmyepqsleakkgfphsgpadgqiasagglfgg
ildqqsenrwfkhimtggehtftwtytaphntsqwhyyitkkgwdpdkplkradfeliga
vphdgspasrnlshhiyipedrlgyhvilavwdvadtenafyqvidvdlvnk