PDB entry 5lw3

View 5lw3 on RCSB PDB site
Description: azotobacter vinelandii mannuronan c-5 epimerase alge6 a-module
Deposited on 2016-09-15, released 2017-10-25
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(beta-D-mannuronate) C5 epimerase 6
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: algE6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, B3P, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lw3A (A:)
    mdynvkdfgalgdgvsddrvaiqaaidaahaagggtvylppgeyrvsaagepsdgcltlr
    dnvylagagmgqtviklvdgsaqkitgivrspfgeetsnfgmrdltldgnrantvdkvdg
    wfngyapgqpgadrnvtiervevremsgygfdpheqtinlvlrdsvahhngldgfvadyq
    iggtfennvayandrhgfnivtstndfvmrnnvaygnggnglvvqrgsenlahpenilid
    ggsyydnglegvlvkmsnnvtvqnadihgngssgvrvygaqgvqilgnqihdnaktavap
    evllqsyddtlgvsgnyyttlntrvegntitgsanstygvqerndgtdfsslvgntingv
    qeaahlygpnstvsgtvsappqgtdle
    

    Sequence, based on observed residues (ATOM records):
    >5lw3A (A:)
    dynvkdfgalgdgvsddrvaiqaaidaahaagggtvylppgeyrvsaagepsdgcltlrd
    nvylagagmgqtviklvdgsaqkitgivrspfgeetsnfgmrdltldgnrantvdkvdgw
    fngyapgqpgadrnvtiervevremsgygfdpheqtinlvlrdsvahhngldgfvadyqi
    ggtfennvayandrhgfnivtstndfvmrnnvaygnggnglvvqrgsenlahpenilidg
    gsyydnglegvlvkmsnnvtvqnadihgngssgvrvygaqgvqilgnqihdnaktavape
    vllqsyddtlgvsgnyyttlntrvegntitgsanstygvqerndgtdfsslvgntingvq
    eaahlygpnstvsgtvsappq