PDB entry 5lw0

View 5lw0 on RCSB PDB site
Description: oryza sativa apl macrodomain in complex with adp-ribose
Deposited on 2016-09-14, released 2016-10-26
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic helix-loop-helix, putative, expressed
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: LOC_Os03g18210
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Basic helix-loop-helix, putative, expressed
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: LOC_Os03g18210
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AR6, PO4, GLY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lw0A (A:)
    mghhhhhhggvkkelsnskkiedqsresvlsdissrtlafpsistadfqfdldrasdiiv
    davadilqkydnirlvlvdlshksrilslvkekaakkninssrfftfvgditqlqskggl
    rcnvianaanwrlkpggggvnaaiynaagedlqratkecadtlrpgssvavplpstsplh
    qregvthiihvlgpnmnpmrpdclkndytkgskilheaytslfenfvaivq
    

    Sequence, based on observed residues (ATOM records):
    >5lw0A (A:)
    lsdissrtlafpsistadfqfdldrasdiivdavadilqkydnirlvlvdlshksrilsl
    vkekaakkninssrfftfvgditqlqskgglrcnvianaanwrlkpggggvnaaiynaag
    edlqratkecadtlrpgssvavplpstsplhqregvthiihvlgpnmnpmrpdclkndyt
    kgskilheaytslfenfvaivq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lw0B (B:)
    mghhhhhhggvkkelsnskkiedqsresvlsdissrtlafpsistadfqfdldrasdiiv
    davadilqkydnirlvlvdlshksrilslvkekaakkninssrfftfvgditqlqskggl
    rcnvianaanwrlkpggggvnaaiynaagedlqratkecadtlrpgssvavplpstsplh
    qregvthiihvlgpnmnpmrpdclkndytkgskilheaytslfenfvaivq
    

    Sequence, based on observed residues (ATOM records):
    >5lw0B (B:)
    svlsdissrtlafpsistadfqfdldrasdiivdavadilqkydnirlvlvdlshksril
    slvkekaakkninssrfftfvgditqlqskgglrcnvianaanwrlkpggggvnaaiyna
    agedlqratkecadtlrpgssvavplpstsplhqregvthiihvlgpnmnpmrpdclknd
    ytkgskilheaytslfenfvaivq