PDB entry 5lvy

View 5lvy on RCSB PDB site
Description: structural studies of the aggregative adherence fimbriae of enteroaggregative escherichia coli
Deposited on 2016-09-14, released 2017-07-26
The last revision was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin protein
    Species: Escherichia coli O111:H21 [TaxId:660582]
    Gene: aaf5A
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9K5V2 (0-122)
      • conflict (104)
      • expression tag (123-153)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lvyA (A:)
    nscslsisspdpvtytiptdkgdkyinfkldvpdprckalggtvyfwgadtrdgklvmkk
    gqdkytlmttyggavqqqlgggygyyhvsqktppqtisgvvsknvgykpgqytveltgff
    slndnkqanptpssltskaagknivsstgtitis