PDB entry 5lvm

View 5lvm on RCSB PDB site
Description: Human PDK1 Kinase Domain in Complex with Adenine Bound to the ATP-Binding Site
Class: transferase
Keywords: protein kinase, allosteric regulation, small compounds, PIF-pocket, transferase
Deposited on 2016-09-14, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15530 (Start-310)
      • engineered mutation (239)
      • engineered mutation (243)
    Domains in SCOPe 2.07: d5lvma_
  • Heterogens: ADE, DTD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lvmA (A:)
    gamdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsrey
    aikilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngell
    kyirkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtak
    vlspeskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneg
    lifakiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwe
    nlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lvmA (A:)
    kkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvms
    rldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaley
    lhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspellt
    eksackssdlwalgciiyqlvaglppfragneglifakiikleydfpekffpkardlvek
    llvldatkrlgceemegygplkahpffesvtwenlhqqtppklt