PDB entry 5lvk

View 5lvk on RCSB PDB site
Description: Human Lysozyme soaked with [H2Ind][trans-RuCl4(DMSO)(HInd)]
Class: hydrolase
Keywords: human lysozyme, ruthenium, Hydrolase
Deposited on 2016-09-14, released 2016-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lvka_
  • Chain 'B':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lvkb_
  • Heterogens: SO4, CL, NA, RU, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lvkA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lvkB (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv