PDB entry 5lvf

View 5lvf on RCSB PDB site
Description: solution structure of rtt103 ctd-interacting domain bound to a thr4 phosphorylated ctd peptide
Deposited on 2016-09-14, released 2017-05-10
The last revision was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of Ty1 transposition protein 103
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: RTT103, YDR289C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05543 (2-130)
      • initiating methionine (0)
      • expression tag (1)
      • expression tag (131-141)
  • Chain 'B':
    Compound: pro-ser-tyr-ser-pro-pth-ser-pro-ser-tyr-ser-pro-thr-ser-pro-ser
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LVF (0-15)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lvfA (A:)
    mafsseqfttklntledsqesissaskwlllqyrdapkvaemwkeymlrpsvntrrkllg
    lylmnhvvqqakgqkiiqfqdsfgkvaaevlgrinqefprdlkkklsrvvnilkernifs
    kqvvndierslaaalehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5lvfB (B:)
    psysptspsysptsps