PDB entry 5lve

View 5lve on RCSB PDB site
Description: structure of the variable domain of human immunoglobulin k-4 light chain len
Class: immune system
Keywords: immunoglobulin, bence-jones protein
Deposited on 1999-02-24, released 2000-02-18
The last revision prior to the SCOP 1.75 freeze date was dated 2001-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones protein len
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01625 (0-113)
      • engineered mutation (94)
    Domains in SCOP 1.75: d5lvea_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lveA (A:)
    divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycaqyystpysfgqgtkleikr