PDB entry 5lv2

View 5lv2 on RCSB PDB site
Description: crystal structure of mouse carm1 in complex with inhibitor lh1246
Deposited on 2016-09-12, released 2017-09-20
The last revision was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAO, EDO, LHB, PG4, M2M, DXE, PEG, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lv2A (A:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2A (A:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lv2B (B:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2B (B:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffry
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lv2C (C:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2C (C:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lv2D (D:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2D (D:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffry
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lv2E (E:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2E (E:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lv2F (F:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2F (F:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffry
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lv2G (G:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2G (G:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5lv2H (H:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5lv2H (H:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffr