PDB entry 5lur

View 5lur on RCSB PDB site
Description: An avidin mutant
Class: biotin binding protein
Keywords: Avidin, antidins, steroids, progesterone, biotin binding protein, Steroid-binding
Deposited on 2016-09-09, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • engineered mutation (16-19)
      • engineered mutation (38-39)
      • engineered mutation (120)
    Domains in SCOPe 2.06: d5lura_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Gene: AVD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • engineered mutation (16-19)
      • engineered mutation (38-39)
      • engineered mutation (120)
    Domains in SCOPe 2.06: d5lurb_
  • Heterogens: STR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lurA (A:)
    qtvnarkcsltgkwtnrmnhnmtigavnsrgeftgtyiatvnatsneikesplhgtqnti
    nkrtqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvg
    yniftrlrtqkehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lurA (A:)
    rkcsltgkwtnrmnhnmtigavnsrgeftgtyiatvneikesplhgtqntinkrtqptfg
    ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvgyniftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lurB (B:)
    qtvnarkcsltgkwtnrmnhnmtigavnsrgeftgtyiatvnatsneikesplhgtqnti
    nkrtqptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvg
    yniftrlrtqkehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lurB (B:)
    kcsltgkwtnrmnhnmtigavnsrgeftgtyiatveikesplhgtqntinkrtqptfgft
    vnwkfsesttvftgqcfidgkevlktmwllrssvndigddwkatrvgyniftrl