PDB entry 5lud

View 5lud on RCSB PDB site
Description: Structure of Cyclophilin A in complex with 2,3-Diaminopyridine
Class: isomerase
Keywords: isomerase, ligand complex, beta barrel, prolyl cis/trans isomerase
Deposited on 2016-09-08, released 2017-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: HEL-S-69p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5luda_
  • Heterogens: 76X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ludA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle