PDB entry 5lu8

View 5lu8 on RCSB PDB site
Description: crystal structure of yvad-cmk bound human legumain (aep) in complex with compound 11b
Deposited on 2016-09-08, released 2017-03-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: legumain
    Species: Homo sapiens [TaxId:9606]
    Gene: LGMN, PRSC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99538 (0-262)
      • engineered mutation (237)
  • Chain 'C':
    Compound: ac-tyr-val-ala-asp-chloromethylketone
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LU8 (Start-4)
  • Heterogens: SO4, NAG, EMC, 5KN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lu8A (A:)
    ggkhwvvivagsngwynyrhqadachayqiihrngipdeqivvmmyddiaysednptpgi
    vinrpngtdvyqgvpkdytgedvtpqnflavlrgdaeavkgigsgkvlksgpqdhvfiyf
    txhgstgilvfpnedlhvkdlnetihymykhkmyrkmvfyieacesgsmmnhlpdninvy
    attaanpressyacyydekrstylgdwysvnwmedsdvedltketlhkqyhlvkshtqts
    hvmqygnktistmkvmqfqgmkr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5lu8C (C:)
    yvadx