PDB entry 5lu3

View 5lu3 on RCSB PDB site
Description: the structure of spirochaeta thermophila cbm64
Deposited on 2016-09-07, released 2017-02-15
The last revision was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 12
    Species: Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203) [TaxId:869211]
    Gene: Spith_0373
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0GE26 (0-83)
      • expression tag (84-87)
  • Heterogens: 2NV, SSN, CA, NI, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lu3A (A:)
    geylemdlpfsydgageylwktddfsttvdwgryvnswnldlleingndytnrwvaqhqv
    ppasdgywyihykgslawshvemklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lu3A (A:)
    geylemdlpfsydgageylwktddfsttvdwgryvnswnldlleingndytnrwvaqhqv
    ppasdgywyihykgslawshvemklehh