PDB entry 5lu2

View 5lu2 on RCSB PDB site
Description: human 14-3-3 sigma complexed with long hspb6 phosphopeptide
Deposited on 2016-09-07, released 2017-02-01
The last revision was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: heat shock protein beta-6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: heat shock protein beta-6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lu2A (A:)
    merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
    vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
    lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
    yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >5lu2A (A:)
    erasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawrv
    lssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfyl
    kmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhy
    eianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lu2B (B:)
    merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
    vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
    lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
    yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >5lu2B (B:)
    erasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawrv
    lssieqksneeekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmk
    gdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeia
    nspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lu2C (C:)
    wlrrasaplpglk
    

    Sequence, based on observed residues (ATOM records):
    >5lu2C (C:)
    rrasaplp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lu2D (D:)
    wlrrasaplpglk
    

    Sequence, based on observed residues (ATOM records):
    >5lu2D (D:)
    rrasaplp