PDB entry 5lu1

View 5lu1 on RCSB PDB site
Description: human 14-3-3 sigma clu3 mutant complexed with short hspb6 phosphopeptide
Deposited on 2016-09-07, released 2017-02-01
The last revision was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (Start-233)
      • engineered mutation (79)
  • Chain 'B':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (0-2)
  • Chain 'C':
    Compound: heat shock protein beta-6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: heat shock protein beta-6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (1-2)
  • Chain 'F':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (0-2)
      • engineered mutation (78-79)
  • Chain 'G':
    Compound: heat shock protein beta-6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: heat shock protein beta-6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lu1A (A:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >5lu1A (A:)
    erasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawrv
    lssieqksneagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgd
    yyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeians
    peeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lu1B (B:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >5lu1B (B:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmk
    gdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeia
    nspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5lu1C (C:)
    rrasaplp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5lu1D (D:)
    rrasaplp
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lu1E (E:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >5lu1E (E:)
    phmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraa
    wrvlssieqksnegpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmk
    gdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeia
    nspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lu1F (F:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records):
    >5lu1F (F:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfyl
    kmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhy
    eianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >5lu1G (G:)
    rrasaplp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5lu1H (H:)
    rrasaplp