PDB entry 5ltz

View 5ltz on RCSB PDB site
Description: GmhA_mutant Q175E
Class: isomerase
Keywords: Cooperativity, enzyme kinetics, hydrogen bonds, molecular modelling, quantum mechanics, isomerase
Deposited on 2016-09-07, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoheptose isomerase
    Species: BURKHOLDERIA PSEUDOMALLEI K96243 [TaxId:272560]
    Gene: gmhA, BPSL2795
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93UJ2
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5ltza_
  • Chain 'B':
    Compound: Phosphoheptose isomerase
    Species: BURKHOLDERIA PSEUDOMALLEI K96243 [TaxId:272560]
    Gene: gmhA, BPSL2795
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93UJ2
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5ltzb_
  • Chain 'C':
    Compound: Phosphoheptose isomerase
    Species: BURKHOLDERIA PSEUDOMALLEI K96243 [TaxId:272560]
    Gene: gmhA, BPSL2795
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93UJ2
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5ltzc_
  • Chain 'D':
    Compound: Phosphoheptose isomerase
    Species: BURKHOLDERIA PSEUDOMALLEI K96243 [TaxId:272560]
    Gene: gmhA, BPSL2795
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93UJ2 (Start-196)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5ltzd_
  • Heterogens: PG4, ZN, I22, EDO, PGE, PEG, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ltzA (A:)
    menreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaa
    daqhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvli
    gystsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlv
    lghivcglvehsifgkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltzA (A:)
    nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
    qhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
    stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlvlg
    hivcglvehsifg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ltzB (B:)
    menreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaa
    daqhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvli
    gystsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlv
    lghivcglvehsifgkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltzB (B:)
    nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
    qhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
    stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlvlg
    hivcglvehsifg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ltzC (C:)
    menreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaa
    daqhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvli
    gystsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlv
    lghivcglvehsifgkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltzC (C:)
    nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
    qhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
    stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlvlg
    hivcglvehsifg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ltzD (D:)
    menreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaa
    daqhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvli
    gystsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlv
    lghivcglvehsifgkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltzD (D:)
    nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
    qhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
    stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkieeghlvlg
    hivcglvehsifgkq