PDB entry 5ltr

View 5ltr on RCSB PDB site
Description: Structure of the Yellow-Green Fluorescent Protein mNeonGreen from Branchiostoma lanceolatum at the near physiological pH 8.0
Class: fluorescent protein
Keywords: fluorescent protein
Deposited on 2016-09-07, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTR
    Domains in SCOPe 2.06: d5ltra_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ltrA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltrA (A:)
    nmaslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphig
    ygfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvk
    gtgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfa
    kpmaanylknqpmyvfrktelkhsktelnfkewqkaftd