SCOPe 2.08: Structural Classification of Proteins

PDB entry 5ltq

View 5ltq on RCSB PDB site
Description: Structure of the Yellow Fluorescent Protein lanYFP from Branchiostoma lanceolatum at pH 7.5
Class: fluorescent protein
Keywords: fluorescent protein
Deposited on 2016-09-07, released 2016-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - expression tag (42-43)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqa1, d5ltqa2
Chain 'B':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - expression tag (43)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqb1, d5ltqb2
Chain 'C':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - expression tag (43)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqc1, d5ltqc2
Chain 'D':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - expression tag (41-43)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqd1, d5ltqd2
Chain 'E':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (Start-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqe_
Chain 'F':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (Start-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
  - expression tag (262-268)
Domains in SCOPe 2.08: d5ltqf1, d5ltqf2
Chain 'G':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqg_
Chain 'H':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (Start-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqh_
Chain 'I':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (Start-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqi_
Chain 'J':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
  - expression tag (262-267)
Domains in SCOPe 2.08: d5ltqj1, d5ltqj2
Chain 'K':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (Start-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqk_
Chain 'L':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - expression tag (43)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltql1, d5ltql2
Chain 'M':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqm_
Chain 'N':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (Start-261)
  - chromophore (101)
  - variant (213)
  - variant (216)
  - expression tag (262-264)
Domains in SCOPe 2.08: d5ltqn1, d5ltqn2
Chain 'O':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqo_
Chain 'P':
Compound: Green fluorescent protein blFP-Y3
Species: Branchiostoma lanceolatum [TaxId:7740]
Gene: blFP-Y3
Database cross-references and differences (RAF-indexed):
- Uniprot B1PNC0 (44-261)
  - expression tag (43)
  - chromophore (101)
  - variant (213)
  - variant (216)
Domains in SCOPe 2.08: d5ltqp1, d5ltqp2
Heterogens: CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5ltqA (A:)
mrgshhhhhhgmasmtggqqmgrdlyddddkdpmvskgeednmaslpathelhifgsfng
vdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfhqylpfpdgmspfqaa
mkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgfpadgpvmtnsltaad
wcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpmaanilknqpmfvfrkt
elkhsktelnfkewqkaftdvmgmdelyk