PDB entry 5ltp

View 5ltp on RCSB PDB site
Description: Structure of the Yellow-Green Fluorescent Protein mNeonGreen from Branchiostoma lanceolatum at the acidic pH 4.5
Class: fluorescent protein
Keywords: fluorescent protein
Deposited on 2016-09-07, released 2016-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTP
    Domains in SCOPe 2.06: d5ltpa_
  • Chain 'B':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTP
    Domains in SCOPe 2.06: d5ltpb1, d5ltpb2
  • Chain 'C':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTP
    Domains in SCOPe 2.06: d5ltpc1, d5ltpc2
  • Chain 'D':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTP
    Domains in SCOPe 2.06: d5ltpd1, d5ltpd2
  • Chain 'E':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTP
    Domains in SCOPe 2.06: d5ltpe1, d5ltpe2
  • Chain 'F':
    Compound: mNeonGreen
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene: blFP-Y3
    Database cross-references and differences (RAF-indexed):
    • PDB 5LTP
    Domains in SCOPe 2.06: d5ltpf1, d5ltpf2
  • Heterogens: CL, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ltpA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltpA (A:)
    ednmaslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvph
    igygfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaq
    vkgtgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttyt
    fakpmaanylknqpmyvfrktelkhsktelnfkewqkaftd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ltpB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltpB (B:)
    ednmaslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvph
    igygfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaq
    vkgtgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttyt
    fakpmaanylknqpmyvfrktelkhsktelnfkewqkaftdvmgmdel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ltpC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltpC (C:)
    maslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigy
    gfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkg
    tgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfak
    pmaanylknqpmyvfrktelkhsktelnfkewqkaftdvmgmdel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ltpD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltpD (D:)
    maslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigy
    gfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkg
    tgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfak
    pmaanylknqpmyvfrktelkhsktelnfkewqkaftdvmgmdely
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ltpE (E:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltpE (E:)
    aslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigyg
    fhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgt
    gfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfakp
    maanylknqpmyvfrktelkhsktelnfkewqkaftdvmgmdel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ltpF (F:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdplemvskgeednmaslpathelhifgsi
    ngvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigygfhqylpypdgmspfq
    aamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgtgfpadgpvmtnslta
    adwcrskktypndktiistfkwsyttgngkryrstarttytfakpmaanylknqpmyvfr
    ktelkhsktelnfkewqkaftdvmgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltpF (F:)
    maslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigy
    gfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkg
    tgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfak
    pmaanylknqpmyvfrktelkhsktelnfkewqkaftdvmgmdely