PDB entry 5ltl

View 5ltl on RCSB PDB site
Description: Structure of human chemokine CCL16
Class: cytokine
Keywords: Chemokine, CC-type, Chemotaxis, cytokine
Deposited on 2016-09-07, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 16
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL16, ILINCK, NCC4, SCYA16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ltla_
  • Chain 'B':
    Compound: C-C motif chemokine 16
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL16, ILINCK, NCC4, SCYA16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ltlb_
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ltlA (A:)
    gpsqpkvpewvntpstcclkyyekvlprrlvvgyrkalnchlpaiifvtkrnrevctnpn
    ddwvqeyikdpnlpllptrnlstvkiitakngqpqllnsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltlA (A:)
    vntpstcclkyyekvlprrlvvgyrkalnchlpaiifvtkrnrevctnpnddwvqeyikd
    pnlpllpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ltlB (B:)
    gpsqpkvpewvntpstcclkyyekvlprrlvvgyrkalnchlpaiifvtkrnrevctnpn
    ddwvqeyikdpnlpllptrnlstvkiitakngqpqllnsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ltlB (B:)
    vntpstcclkyyekvlprrlvvgyrkalnchlpaiifvtkrnrevctnpnddwvqeyikd
    pnlpllptr