PDB entry 5lth

View 5lth on RCSB PDB site
Description: crystal structure of the alpha subunit of heme dependent oxidative n- demethylase (hodm) in complex with the dimethylamine substrate
Deposited on 2016-09-06, released 2016-11-09
The last revision was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heme dependent oxidative N-demethylase
    Species: Pseudomonas mendocina [TaxId:300]
    Gene: Pmen_3455
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, DMN, PEG, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lthA (A:)
    mtltfkplesyredfsfrnspaaiarfpfpfpedqymysvnlepavsrdpgsvfehqfdv
    dehyvsemaerarvleldpgrclvmphmaqaawdtlamlmehlardypqhfrltrqgdaw
    hwqnlalgidqrftfgdpaslpcepleyitrqmqgdfavldqrdgdlfmdagmvtcpadw
    slrfdagmsfkqwhspvpmahqmgvfdralkyllniqvgapvrrlnwtltinprldtspe
    tyhewgndrgkvtpdnvgrlvhlrvelqlmarlprsnallfgirtylisldelvsnpawa
    qrlhrvmrdlpdpiadykgitryrqtlvdwlrrfdpeahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lthA (A:)
    fkplesyredfsfrnspaaiarfpfpfpedqymysvnlepavsrdpgsvfehqfdvdehy
    vsemaerarvleldpgrclvmphmaqaawdtlamlmehlardypqhfrltrqgdawhwqn
    lalgidqrftfgdpaslpcepleyitrqmqgdfavldqrdgdlfmdagmvtcpadwslrf
    dagmsfkqwhspvpmahqmgvfdralkyllniqvgapvrrlnwtltinprldtspetyhe
    wgndrgkvtpdnvgrlvhlrvelqlmarlprsnallfgirtylisldelvsnpawaqrlh
    rvmrdlpdpiadykgitryrqtlvdwlrrfdpea