PDB entry 5ltf

View 5ltf on RCSB PDB site
Description: crystal structure of lymphocytic choriomeningitis mammarenavirus endonuclease complexed with catalytic ions
Deposited on 2016-09-06, released 2017-09-13
The last revision was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-directed RNA polymerase L
    Species: Lymphocytic choriomeningitis mammarenavirus [TaxId:11623]
    Gene: L, KUE_IGS320002
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059U381 (8-End)
      • expression tag (7)
      • engineered mutation (180)
  • Chain 'B':
    Compound: RNA-directed RNA polymerase L
    Species: Lymphocytic choriomeningitis mammarenavirus [TaxId:11623]
    Gene: L, KUE_IGS320002
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059U381 (8-End)
      • expression tag (3-7)
      • engineered mutation (180)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ltfA (A:)
    mkhhhhhhdeiiselrelclnyieqderlsrqklnflgqreprmvlieglkllsrcieid
    sadksgcthnhddksvetilvesgivcpglpliipdgyklidnslillecfvrstpasfe
    kkfiedtnklaciredlavagvtlvpivdgrcdydnsfmpewanfkfrdllfklleysnq
    dekvfeeseyfrlceslkttidkr
    

    Sequence, based on observed residues (ATOM records):
    >5ltfA (A:)
    hdeiiselrelclnyieqderlsrqklnflgqreprmvlieglkllsrcieidsadksgc
    thnhddksvetilvesgivcpglpliipdgyklidnslillecfvrstpasfekkfiedt
    nklaciredlavagvtlvpivdgrcdydnsfmpewanfkfrdllfklleysnqdekvfee
    seyfrlce
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ltfB (B:)
    mkhhhhhhdeiiselrelclnyieqderlsrqklnflgqreprmvlieglkllsrcieid
    sadksgcthnhddksvetilvesgivcpglpliipdgyklidnslillecfvrstpasfe
    kkfiedtnklaciredlavagvtlvpivdgrcdydnsfmpewanfkfrdllfklleysnq
    dekvfeeseyfrlceslkttidkr
    

    Sequence, based on observed residues (ATOM records):
    >5ltfB (B:)
    hhhhhdeiiselrelclnyieqderlsrqklnflgqreprmvlieglkllsrcieidsad
    ksgcthnhddksvetilvesgivcpglpliipdgyklidnslillecfvrstpasfekkf
    iedtnklaciredlavagvtlvpivdgrcdydnsfmpewanfkfrdllfklleysnqdek
    vfeeseyfrlceslkttid