PDB entry 5lt7

View 5lt7 on RCSB PDB site
Description: structure of the epigenetic oncogene mmset and inhibition by n-alkyl sinefungin derivatives
Deposited on 2016-09-06, released 2016-10-05
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD2
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD2, HIF1, HYPB, KIAA1732, KMT3A, SET2, HSPC069
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, SCN, 76L, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lt7A (A:)
    mhhhhhhssgrenlyfqgetsvppgsalvgpscvmddfrdpqrwkecakqgkmpcyfdli
    eenvylterkknkshrdikrmqcectplskderaqgeiacgedclnrllmiecssrcpng
    dycsnrrfqrkqhadveviltekkgwglraakdlpsntfvleycgevldhkefkarvkey
    arnknihyyfmalkndeiidatqkgncsrfmnhscepncetqkwtvngqlrvgffttklv
    psgseltfdyqfqrygkeaqkcfcgsancrgylggenrvsiraaggkmkkersrk
    

    Sequence, based on observed residues (ATOM records):
    >5lt7A (A:)
    getsvppgsalvgpscvmddfrdpqrwkecakqgkmpcyfdlieenvylmqcectpliac
    gedclnrllmiecssrcpngdycsnrrfqrkqhadveviltekkgwglraakdlpsntfv
    leycgevldhkefkarvkeyarnknihyyfmalkndeiidatqkgncsrfmnhscepnce
    tqkwtvngqlrvgffttklvpsgseltfdyqfqrygkeaqkcfcgsancrgylggenrvs
    ira