PDB entry 5lsv

View 5lsv on RCSB PDB site
Description: x-ray crystal structure of aa13 lpmo
Deposited on 2016-09-05, released 2017-01-18
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AoAA13
    Species: Aspergillus oryzae RIB40 [TaxId:510516]
    Gene: AO090701000246
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5lsvA (A:)
    hgymyipssrtrlgheagidscpecailepvsswpdldaapvgrsgpcgynardsidynq
    pttnwgsdavqsyspgeeievqwcvdhngdhggmftyricqdqsivdkfldpsylptnde
    kqaaedcfdagllpctdvsgqecgysadctegeacwrndwftcngfeasdrpkcqgvdna
    elnscytsiaggytvtkkvklpeytsnhtlisfkwnsfqtgqiylscadiaiq