PDB entry 5lsm

View 5lsm on RCSB PDB site
Description: crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1
Deposited on 2016-09-04, released 2016-09-14
The last revision was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: FMN-dependent nitronate monooxygenase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: SO_0471
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FMN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lsmA (A:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmA (A:)
    crltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsqt
    akpinvnffchrepvaqaakqaawleqlapyfaefnldpnrtpyskaqaevlakfkpevv
    sfhfglpdeellleikswgskvistattveealwleargadaiiaqgleagghrghflse
    dlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecnt
    saihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrt
    aaerlgfwdfsplwcgqnasgcraipaadltrsfvlslp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lsmB (B:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmB (B:)
    crltrlfiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsqta
    kpinvnffchrepvqakqaawleqlapyfaefnldpnrtpyskaqaevlakfkpevvsfh
    fglpdeellleikswgskvistattveealwleargadaiiaqgleagghrghflsedlt
    eqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecntsai
    hrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrtaae
    rlgfwdfsplwcgqnasgcraipaadltrsfv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lsmC (C:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmC (C:)
    crltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsqt
    akpinvnffchrepvaqaakqaawleqlapyfaefnltpyskaqaevlakfkpevvsfhf
    glpdeellleikswgskvistattveealwleargadaiiaqgleagghrghflsedlte
    qlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecntsaih
    realqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrtaaer
    lgfwdfsplwcgqnasgcraipaadltrsfvlslssve
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lsmD (D:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmD (D:)
    mpcrltrlfgefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsq
    takpinvnffchrepvqaakqaawleqlapyfaefnlpnrtpyskaqaevlakfkpevvs
    fhfglpdeellleikswskvistattveealwleargadaiiaqgleagghrghflsedl
    teqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecntsa
    ihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrtaa
    erlgfwdfsplwcgqnasgcraipaadltrsfv
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lsmE (E:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmE (E:)
    mpcrltrlfefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsqt
    akpinvnffchrepaqaakqaawleqlapyfaefnldpnaqrtpyskaqaevlakfkpev
    vsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleagghrghfls
    edlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecn
    tsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglr
    taaerlgfwdfsplwcgqnasgcraipaadltrsfvlsl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lsmF (F:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmF (F:)
    crltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsqt
    akpinvnffchrepvaqaakqaawleqlapyfaefnlrtpyskaqaevlakfkpevvsfh
    fglpdeellleikswgskvistattveealwleargadaiiaqgleagghrghflsedlt
    eqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecntsai
    hrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrtaae
    rlgfwdfsplwcgqnasgcraipaadltrsfvlslps
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lsmG (G:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmG (G:)
    crltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsqt
    akpinvnffchvakqaawleqlapyfaefnldqrtpyskaqaevlakfkpevvsfhfglp
    deellleikswgskvistattveealwleargadaiiaqgleagghrghflsedlteqlg
    tfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecntsaihrea
    lqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrtaaerlgf
    wdfsplwcgqnasgcraipaadltrsfvlsl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5lsmH (H:)
    mpcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairs
    qtakpinvnffchrepvaqaakqaawleqlapyfaefnldpnaqpagaqrtpyskaqaev
    lakfkpevvsfhfglpdeellleikswgskvistattveealwleargadaiiaqgleag
    ghrghflsedlteqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgta
    yllcpecntsaihrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfpla
    ssavaglrtaaerlgfwdfsplwcgqnasgcraipaadltrsfvlslpsscvepqeksg
    

    Sequence, based on observed residues (ATOM records):
    >5lsmH (H:)
    pcrltrlfgiefpiiqapmagvqgsalaiavseagglgslpcamlslealeaeltairsq
    takpinvnffchrepvaqaakqaawleqlapyfaefldtpyskaqaevlakfkpevvsfh
    fglpdeellleikswgskvistattveealwleargadaiiaqgleagghrghflsedlt
    eqlgtfsllpqiiaaveipviaaggivdattvraamtmgasavqvgtayllcpecntsai
    hrealqsdaaqhtaltnlfsgrpargivnrfmaemgpmneavpdfplassavaglrtaae
    rlgfwdfsplwcgqnasgcraipaadltrsf