PDB entry 5lsh

View 5lsh on RCSB PDB site
Description: human lysozyme in complex with a tetrasaccharide fragment of the O-chain of LPS from Klebsiella pneumoniae
Class: sugar binding protein
Keywords: lectin, complex, LPS, O-chain, sugar binding protein
Deposited on 2016-08-26, released 2017-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Gene: LYZ, LZM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5lsha_
  • Heterogens: CL, NA, KTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lshA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv