PDB entry 5lsg

View 5lsg on RCSB PDB site
Description: PPARgamma complex with the betulinic acid
Class: signaling protein
Keywords: Antagonist, Complex, Transcription Factor, Nuclear Receptor, signaling protein
Deposited on 2016-08-26, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lsga_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lsgb_
  • Heterogens: QZQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lsgA (A:)
    mgsshhhhhhssglvprgshmaeissdidqlnpesadlralakhlydsyiksfpltkaka
    railtgkttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveav
    qeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtrefl
    kslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnl
    lqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiy
    kdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lsgA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikeva
    irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
    vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
    gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
    tetdmslhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lsgB (B:)
    mgsshhhhhhssglvprgshmaeissdidqlnpesadlralakhlydsyiksfpltkaka
    railtgkttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveav
    qeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtrefl
    kslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnl
    lqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiy
    kdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lsgB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktetdmslhpllqeiy