PDB entry 5lsc

View 5lsc on RCSB PDB site
Description: The structure of the metallo-beta-lactamase VIM-2 in complex with a triazolylthioacetamide inhibitor
Class: hydrolase
Keywords: Antibiotic resistance, Carbapenemases, Verona integron-encoded metallo-beta-lactamase 2, VIM-2, hydrolase
Deposited on 2016-08-25, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase VIM-2-like protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lsca_
  • Chain 'B':
    Compound: Metallo-beta-lactamase VIM-2-like protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lscb_
  • Heterogens: CL, 752, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lscA (A:)
    vdssgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidta
    wgakntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeve
    gneipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrt
    sagnvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lscA (A:)
    sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
    kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
    ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
    nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lscB (B:)
    vdssgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidta
    wgakntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeve
    gneipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrt
    sagnvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lscB (B:)
    sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
    kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
    ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
    nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv