PDB entry 5ls9

View 5ls9 on RCSB PDB site
Description: Humanized Archaeal ferritin
Class: metal binding protein
Keywords: chimeric protein ferritin metal binding protein, METAL BINDING PROTEIN
Deposited on 2016-08-23, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9a_
  • Chain 'B':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9b_
  • Chain 'C':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9c_
  • Chain 'D':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9d_
  • Chain 'E':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9e_
  • Chain 'F':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9f_
  • Chain 'G':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9g_
  • Chain 'H':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9h_
  • Chain 'I':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9i_
  • Chain 'J':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9j_
  • Chain 'K':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9k_
  • Chain 'L':
    Compound: Ferritin, putative
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0834
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • engineered mutation (53)
      • engineered mutation (69-70)
      • engineered mutation (72-76)
      • engineered mutation (78)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d5ls9l_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ls9A (A:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9A (A:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ls9B (B:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9B (B:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ls9C (C:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9C (C:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ls9D (D:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9D (D:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ls9E (E:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9E (E:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ls9F (F:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9F (F:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqftp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ls9G (G:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9G (G:)
    asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfd
    fvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynf
    lqwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ls9H (H:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9H (H:)
    asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfd
    fvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynf
    lqwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ls9I (I:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9I (I:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5ls9J (J:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9J (J:)
    asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfd
    fvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynf
    lqwyvaeqveeeasaldiveklrligedkrallfldkelslrqf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5ls9K (K:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9K (K:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqft
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ls9L (L:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmf
    dfvserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls9L (L:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelchamkmfdf
    vserggriflqdikkpdsewesplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrqft