PDB entry 5ls7

View 5ls7 on RCSB PDB site
Description: complex of wild type e. coli alpha aspartate decarboxylase with its processing factor panz
Deposited on 2016-08-22, released 2017-09-13
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate 1-decarboxylase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: panD, b0131, JW0127
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A790 (17-40)
      • expression tag (16)
  • Chain 'B':
    Compound: PanD maturation factor
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: panM, panZ, yhhK, b3459, JW3424
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37613 (0-126)
      • expression tag (127)
  • Chain 'D':
    Compound: Aspartate 1-decarboxylase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: panD, b0131, JW0127
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, PEG, ACO, MG, CO2, SCN, 74C, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ls7A (A:)
    mrgshhhhhhglvprgsmirtmlqgklhrvkvthadlhyeg
    

    Sequence, based on observed residues (ATOM records):
    >5ls7A (A:)
    smirtmlqgklhrvkvthadlhyeg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ls7B (B:)
    mkltiirlekfsdqdridlqkiwpeyspsslqvddnhriyaarfnerllaavrvtlsgte
    galdslrvrevtrrrgvgqylleevlrnnpgvscwwmadagvedrgvmtafmqalgftaq
    qggwekcsglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5ls7B (B:)
    mkltiirlekfsdqdridlqkiwpeyspsslqvddnhriyaarfnerllaavrvtlsgte
    galdslrvrevtrrrgvgqylleevlrnnpgvscwwmadagvedrgvmtafmqalgftaq
    qggwekcs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5ls7D (D:)
    xcaidqdfldaagileneaidiwnvtngkrfstyaiaaergsriisvngaaahcasvgdi
    viiasfvtmpdeeartwrpnvayfegdnemkrtakaipvqva