PDB entry 5ls0

View 5ls0 on RCSB PDB site
Description: Crystal structure of Inorganic Pyrophosphatase PPA1 from Arabidopsis thaliana
Class: hydrolase
Keywords: inorganic pyrophosphatase, hydrolase, OB-fold
Deposited on 2016-08-22, released 2017-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble inorganic pyrophosphatase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPA1, At1g01050, T25K16.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ls0a_
  • Chain 'B':
    Compound: Soluble inorganic pyrophosphatase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PPA1, At1g01050, T25K16.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ls0b_
  • Heterogens: MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ls0A (A:)
    svaahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnyg
    fvprtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeyk
    hytdikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyilh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ls0A (A:)
    ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
    rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
    dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ls0B (B:)
    svaahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnyg
    fvprtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeyk
    hytdikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyilh