PDB entry 5lrr

View 5lrr on RCSB PDB site
Description: the transcriptional regulator prfa from listeria monocytogenes in complex with glutathione
Deposited on 2016-08-19, released 2016-12-07
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Listeriolysin positive regulatory factor A
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: prfA, M643_11230
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GSH, NA, PI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lrrA (A:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrA (A:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lrrB (B:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrB (B:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5lrrC (C:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrC (C:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5lrrD (D:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrD (D:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5lrrE (E:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrE (E:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5lrrF (F:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrF (F:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelavsriis
    klkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5lrrG (G:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrG (G:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5lrrH (H:)
    mnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records):
    >5lrrH (H:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgysavsr
    iisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln