PDB entry 5lrb

View 5lrb on RCSB PDB site
Description: plastidial phosphorylase from barley in complex with acarbose
Deposited on 2016-08-18, released 2017-05-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-1,4 glucan phosphorylase
    Species: Hordeum vulgare var. distichum [TaxId:112509]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2E0G2 (Start-925)
      • expression tag (926)
  • Chain 'B':
    Compound: Alpha-1,4 glucan phosphorylase
    Species: Hordeum vulgare var. distichum [TaxId:112509]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2E0G2 (Start-925)
      • expression tag (926)
  • Heterogens: GLC, PLP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lrbA (A:)
    mrsvasdrevrgpasteeelsavltsidssaiasniqhhadftplfspehssplkayhat
    aksvfdslimnwnatydyynkvnakqayylsmeflqgraltnaignleltgqyaealkql
    ghnledvasqepdpalgngglgrlascfldslatlnypawgyglryryglfkqiitkdgq
    eevaenwlemgnpweivrndvsypvkfygkvvegtdgrkhwiggenikavahdvpipgyk
    tkttnnlrlwsttvpsqnfdlgafnagdhakaneahlnaekichvlypgdessegkilrl
    kqqytlcsaslqdiisrfesragdslnwedfpskvavqmndthptlcipelmrilmdikg
    lswneawsitertvaytnhtvlpealekwsldimqkllprhveiietideelmnnivsky
    gtadisllkqklkdmrildnvdlpasvaklfikpkekrgkllveslesiaeadektesqe
    venilsettekkaesdseeapdaekedpeyeldpfakydpqfprvvrmanlcvvgghsvn
    gvaeihseivkqdvfnsfyemwptkfqnktngvtprrwirfcnpelstiiskwigsddwi
    lntdklaglkkfaddedlqsewrtakrnnkmkvvslirdktgyivspdamfdvqvkrihe
    ykrqllnilgivyrykkmkemsakdrrksfvprvcifggkafatyvqakrivkfitdvaa
    tvnydpdigdllkvvfvpdynvsvaetlipaselsqhistagmeasgtsnmkfamngcll
    igtldganveireevgeenfflfgahapeiaglrqeraegkfvpdlrfeevkeyvrsgvf
    gtsnydelmgslegnegygradyflvgkdfpsyiecqekvdeayrdqklwtrmsilntag
    spkfssdrtiheyakdiwdispvimptfpdienlyfqg
    

    Sequence, based on observed residues (ATOM records):
    >5lrbA (A:)
    idssaiasniqhhadftplfspehssplkayhataksvfdslimnwnatydyynkvnakq
    ayylsmeflqgraltnaignleltgqyaealkqlghnledvasqepdpalgngglgrlas
    cfldslatlnypawgyglryryglfkqiitkdgqeevaenwlemgnpweivrndvsypvk
    fygkvvegtdgrkhwiggenikavahdvpipgyktkttnnlrlwsttvpsqnfdlgafna
    gdhakaneahlnaekichvlypgdessegkilrlkqqytlcsaslqdiisrfesragdsl
    nwedfpskvavqmndthptlcipelmrilmdikglswneawsitertvaytnhtvlpeal
    ekwsldimqkllprhveiietideelmnnivskygtadisllkqklkdmrildnvdlpas
    vaklfikeldpfakydpqfprvvrmanlcvvgghsvngvaeihseivkqdvfnsfyemwp
    tkfqnktngvtprrwirfcnpelstiiskwigsddwilntdklaglkkfaddedlqsewr
    takrnnkmkvvslirdktgyivspdamfdvqvkriheykrqllnilgivyrykkmkemsa
    kdrrksfvprvcifggkafatyvqakrivkfitdvaatvnydpdigdllkvvfvpdynvs
    vaetlipaselsqhistagmeasgtsnmkfamngclligtldganveireevgeenfflf
    gahapeiaglrqeraegkfvpdlrfeevkeyvrsgvfgtsnydelmgslegnegygrady
    flvgkdfpsyiecqekvdeayrdqklwtrmsilntagspkfssdrtiheyakdiwdispv
    impt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lrbB (B:)
    mrsvasdrevrgpasteeelsavltsidssaiasniqhhadftplfspehssplkayhat
    aksvfdslimnwnatydyynkvnakqayylsmeflqgraltnaignleltgqyaealkql
    ghnledvasqepdpalgngglgrlascfldslatlnypawgyglryryglfkqiitkdgq
    eevaenwlemgnpweivrndvsypvkfygkvvegtdgrkhwiggenikavahdvpipgyk
    tkttnnlrlwsttvpsqnfdlgafnagdhakaneahlnaekichvlypgdessegkilrl
    kqqytlcsaslqdiisrfesragdslnwedfpskvavqmndthptlcipelmrilmdikg
    lswneawsitertvaytnhtvlpealekwsldimqkllprhveiietideelmnnivsky
    gtadisllkqklkdmrildnvdlpasvaklfikpkekrgkllveslesiaeadektesqe
    venilsettekkaesdseeapdaekedpeyeldpfakydpqfprvvrmanlcvvgghsvn
    gvaeihseivkqdvfnsfyemwptkfqnktngvtprrwirfcnpelstiiskwigsddwi
    lntdklaglkkfaddedlqsewrtakrnnkmkvvslirdktgyivspdamfdvqvkrihe
    ykrqllnilgivyrykkmkemsakdrrksfvprvcifggkafatyvqakrivkfitdvaa
    tvnydpdigdllkvvfvpdynvsvaetlipaselsqhistagmeasgtsnmkfamngcll
    igtldganveireevgeenfflfgahapeiaglrqeraegkfvpdlrfeevkeyvrsgvf
    gtsnydelmgslegnegygradyflvgkdfpsyiecqekvdeayrdqklwtrmsilntag
    spkfssdrtiheyakdiwdispvimptfpdienlyfqg
    

    Sequence, based on observed residues (ATOM records):
    >5lrbB (B:)
    idssaiasniqhhadftplfspehssplkayhataksvfdslimnwnatydyynkvnakq
    ayylsmeflqgraltnaignleltgqyaealkqlghnledvasqepdpalgngglgrlas
    cfldslatlnypawgyglryryglfkqiitkdgqeevaenwlemgnpweivrndvsypvk
    fygkvvegtdgrkhwiggenikavahdvpipgyktkttnnlrlwsttvpsqnfdlgafna
    gdhakaneahlnaekichvlypgdessegkilrlkqqytlcsaslqdiisrfesragdsl
    nwedfpskvavqmndthptlcipelmrilmdikglswneawsitertvaytnhtvlpeal
    ekwsldimqkllprhveiietideelmnnivskygtadisllkqklkdmrildnvdlpas
    vaklfikeldpfakydpqfprvvrmanlcvvgghsvngvaeihseivkqdvfnsfyemwp
    tkfqnktngvtprrwirfcnpelstiiskwigsddwilntdklaglkkfaddedlqsewr
    takrnnkmkvvslirdktgyivspdamfdvqvkriheykrqllnilgivyrykkmkemsa
    kdrrksfvprvcifggkafatyvqakrivkfitdvaatvnydpdigdllkvvfvpdynvs
    vaetlipaselsqhistagmeasgtsnmkfamngclligtldganveireevgeenfflf
    gahapeiaglrqeraegkfvpdlrfeevkeyvrsgvfgtsnydelmgslegnegygrady
    flvgkdfpsyiecqekvdeayrdqklwtrmsilntagspkfssdrtiheyakdiwdispv
    impt