PDB entry 5lqv

View 5lqv on RCSB PDB site
Description: Spatial structure of the lentil lipid transfer protein in complex with anionic lysolipid LPPG
Class: lipid transport
Keywords: plant defense peptide lipid transfer protein lens culinaris complex with lipid, STRUCTURE FROM CYANA 3.0, lipid transfer, LIPID TRANSPORT
Deposited on 2016-08-17, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-specific lipid-transfer protein 2
  Species: Lens culinaris [TaxId:3864]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0AT29 (0-92)
  Domains in SCOPe 2.07: d5lqva_
• Heterogens: PGM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5lqvA (A:)
  aiscgavtsdlspcltyltggpgpspqccggvkkllaaanttpdrqaacnclksaagsit
  klntnnaaalpgkcgvnipykistttncntvkf