PDB entry 5lqq

View 5lqq on RCSB PDB site
Description: structure of autotaxin (enpp2) with lm350
Deposited on 2016-08-17, released 2016-12-28
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Enpp2, Atx, Npps2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64610
      • engineered mutation (374)
      • cloning artifact (555)
      • engineered mutation (770)
  • Heterogens: ZN, CA, IOD, 72P, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lqqA (A:)
    aewdegpptvlsdspwtntsgsckgrcfelqevgppdcrcdnlcksysscchdfdelclk
    targwectkdrcgevrneenachcsedclsrgdcctnyqvvckgeshwvdddceeikvpe
    cpagfvrppliifsvdgfrasymkkgskvmpnieklrscgthapymrpvyptktfpnlyt
    latglypeshgivgnsmydpvfdasfhlrgrekfnhrwwggqplwitatkqgvragtffw
    svsipherriltilqwlslpdnerpsvyafyseqpdfsghkygpfgpemtnplreidktv
    gqlmdglkqlrlhrcvnvifvgdhgmedvtcdrteflsnyltnvdditlvpgtlgrirak
    sinnskydpktiiaaltckkpdqhfkpymkqhlpkrlhyannrriedihllvdrrwhvar
    kpldvykkpsgkcffqgdhgfdnkvnsmqtvfvgygptfkyrtkvppfenielynvmcdl
    lglkpapnngthgslnhllrtntfrptmpdevsrpnypgimylqsefdlgctcddkvepk
    nkleefnkrlhtkgstkerhllygrpavlyrtsydilyhtdfesgyseiflmplwtsyti
    skqaevssipehltncvrpdvrvspgfsqnclaykndkqmsygflfppylssspeakyda
    flvtnmvpmypafkrvwayfqrvlvkkyaserngvnvisgpifdynydglrdtedeikqy
    vegssipvpthyysiitscldftqpadkcdgplsvssfilphrpdndescassedeskwv
    eelmkmhtarvrdiehltgldfyrktsrsyseiltlktylhtyesei
    

    Sequence, based on observed residues (ATOM records):
    >5lqqA (A:)
    gsckgrcfelqevgppdcrcdnlcksysscchdfdelclktargwectkdrcgevrneen
    achcsedclsrgdcctnyqvvckgeshwvdddceeikvpecpagfvrppliifsvdgfra
    symkkgskvmpnieklrscgthapymrpvyptktfpnlytlatglypeshgivgnsmydp
    vfdasfhlrgrekfnhrwwggqplwitatkqgvragtffwsvsipherriltilqwlslp
    dnerpsvyafyseqpdfsghkygpfgpemtnplreidktvgqlmdglkqlrlhrcvnvif
    vgdhgmedvtcdrteflsnyltnvdditlvpgtlgriraksinnskydpktiiaaltckk
    pdqhfkpymkqhlpkrlhyannrriedihllvdrrwhvarkpldfqgdhgfdnkvnsmqt
    vfvgygptfkyrtkvppfenielynvmcdllglkpapnngthgslnhllrtntfrptmpd
    evsrpnypgimylqsefdlgctckgstkerhllygrpavlyrtsydilyhtdfesgysei
    flmplwtsytiskqaevssipehltncvrpdvrvspgfsqnclaykndkqmsygflfppy
    lssspeakydaflvtnmvpmypafkrvwayfqrvlvkkyaserngvnvisgpifdynydg
    lrdtedeikqyvegssipvpthyysiitscldftqpadkcdgplsvssfilphrpdndes
    cassedeskwveelmkmhtarvrdiehltgldfyrktsrsyseiltlktylhtye