PDB entry 5lqb

View 5lqb on RCSB PDB site
Description: Complex structure of human IL2 mutant, Proleukin, with Fab fragment of NARA1 antibody
Class: cytokine
Keywords: IL2, Proleukin, NARA1, anti-IL2, cytokine
Deposited on 2016-08-16, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568 (Start-131)
      • engineered mutation (123)
    Domains in SCOPe 2.06: d5lqba_
  • Chain 'H':
    Compound: anti-hIL2 FAB fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LQB (0-End)
  • Chain 'L':
    Compound: anti-hIL2 FAB fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5LQB (0-End)
    Domains in SCOPe 2.06: d5lqbl1, d5lqbl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lqbA (A:)
    ptssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqclee
    elkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrw
    itfsqsiistlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqbA (A:)
    stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
    leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfs
    qsiistlt
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5lqbL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lqbL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne