PDB entry 5lq2

View 5lq2 on RCSB PDB site
Description: crystal structure of tyr24 phosphorylated annexin a2 at 3.4 a resolution
Deposited on 2016-08-15, released 2017-07-05
The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin a2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA2, ANX2, ANX2L4, CAL1H, LPC2D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07355 (Start-337)
      • engineered mutation (64)
  • Chain 'B':
    Compound: annexin a2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA2, ANX2, ANX2L4, CAL1H, LPC2D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07355 (Start-337)
      • engineered mutation (64)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lq2A (A:)
    stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt
    nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl
    gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae
    dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml
    esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml
    kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
    

    Sequence, based on observed residues (ATOM records):
    >5lq2A (A:)
    psaygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtk
    kelasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqel
    qeinrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlyd
    agvkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlv
    qciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiq
    qdtkgdyqkallylcggdd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lq2B (B:)
    stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt
    nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl
    gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae
    dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml
    esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml
    kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
    

    Sequence, based on observed residues (ATOM records):
    >5lq2B (B:)
    psaygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtk
    kelasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqel
    qeinrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlyd
    agvkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlv
    qciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiq
    qdtkgdyqkallylcggdd