PDB entry 5lq1

View 5lq1 on RCSB PDB site
Description: 1.41 a resolution structure of ptxb from trichodesmium erythraeum ims101 in complex with methylphosphonate
Deposited on 2016-08-15, released 2017-12-06
The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphonate ABC transporter, periplasmic phosphonate-binding protein
    Species: Trichodesmium erythraeum IMS101 [TaxId:203124]
    Gene: Tery_0366
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phosphonate ABC transporter, periplasmic phosphonate-binding protein
    Species: Trichodesmium erythraeum IMS101 [TaxId:203124]
    Gene: Tery_0366
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GB, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5lq1A (A:)
    mniqksenkanpqklvvallpdesaatviqnnkglemylenklnkdielfvstdyssmie
    vaskgrldlayfgplsyvlaktksniepfaalekdgkntyqalvignaeaginsyekieg
    kimaygdqastsshlipksmlkqkqlkagenyeevfvgahdavaiavangkaqagglskp
    iftaliergtidknkviiiaeskpfpqypwtmrsdldselktqiqqafleledkailkpf
    kadaftlvtdqdydvvrnlgevlelnfeqlnklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lq1A (A:)
    kanpqklvvallpdesaatviqnnkglemylenklnkdielfvstdyssmievaskgrld
    layfgplsyvlaktksniepfaalekdgkntyqalvignaeaginsyekiegkimaygdq
    astsshlipksmlkqkqlkagenyeevfvgahdavaiavangkaqagglskpiftalier
    gtidknkviiiaeskpfpqypwtmrsdldselktqiqqafleledkailkpfkadaftlv
    tdqdydvvrnlgevlelnfe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5lq1B (B:)
    mniqksenkanpqklvvallpdesaatviqnnkglemylenklnkdielfvstdyssmie
    vaskgrldlayfgplsyvlaktksniepfaalekdgkntyqalvignaeaginsyekieg
    kimaygdqastsshlipksmlkqkqlkagenyeevfvgahdavaiavangkaqagglskp
    iftaliergtidknkviiiaeskpfpqypwtmrsdldselktqiqqafleledkailkpf
    kadaftlvtdqdydvvrnlgevlelnfeqlnklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5lq1B (B:)
    kanpqklvvallpdesaatviqnnkglemylenklnkdielfvstdyssmievaskgrld
    layfgplsyvlaktksniepfaalekdgkntyqalvignaeaginsyekiegkimaygdq
    astsshlipksmlkqkqlkagenyeevfvgahdavaiavangkaqagglskpiftalier
    gtidknkviiiaeskpfpqypwtmrsdldselktqiqqafleledkailkpfkadaftlv
    tdqdydvvrnlgevle