PDB entry 5lpu

View 5lpu on RCSB PDB site
Description: Crystal structure of Annexin A2 complexed with S100A4
Class: calcium-binding protein
Keywords: Calcium-binding protein, protein-protein complex
Deposited on 2016-08-15, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin a2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA2, ANX2, ANX2L4, CAL1H, LPC2D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07355 (0-337)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5lpua_
  • Chain 'B':
    Compound: annexin a2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANXA2, ANX2, ANX2L4, CAL1H, LPC2D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07355 (0-337)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d5lpub_
  • Chain 'C':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpuc_
  • Chain 'D':
    Compound: Protein S100-A4
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A4, CAPL, MTS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26447 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5lpud1, d5lpud2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lpuA (A:)
    stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt
    nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl
    gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae
    dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml
    esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml
    kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5lpuB (B:)
    stvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnilt
    nrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkgl
    gtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrrae
    dgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydml
    esirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdml
    kirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lpuC (C:)
    gshmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqk
    lmsnldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpuC (C:)
    acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
    ldsnrdnevdfqeycvflsciammcneff
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lpuD (D:)
    gshmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqk
    lmsnldsnrdnevdfqeycvflsciammcneffegfpdkqprkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpuD (D:)
    shmacplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqkl
    msnldsnrdnevdfqeycvflsciammcneffegf