PDB entry 5lpq

View 5lpq on RCSB PDB site
Description: tRNA guanine Transglycosylase (TGT) in co-crystallized complex (space group P21) with 6-amino-4-(2-((3aR,4R,6R,6aR)-6-methoxy-2,2-dimethyltetrahydrofuro[3,4-d][1,3]dioxol-4-yl)ethyl)-2-(methylamino)-1H-imidazo[4,5-g]quinazolin-8(7H)-one
Class: transferase
Keywords: Carbohydrate-based Inhibitors, homodimer, shigellosis, TRANSFERASE, TRANSFERASE INHIBITOR
Deposited on 2016-08-14, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (Start-385)
      • conflict (311)
    Domains in SCOPe 2.07: d5lpqa_
  • Chain 'B':
    Compound: Queuine tRNA-ribosyltransferase
    Species: Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720 (Start-385)
      • conflict (311)
    Domains in SCOPe 2.07: d5lpqb_
  • Heterogens: ZN, 72C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lpqA (A:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpqA (A:)
    drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatgadiilgntyhlmlrpgae
    riaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldgsrhmlspersi
    eiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgi
    qqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmg
    vgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechca
    vcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfrary
    farns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lpqB (B:)
    mveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvr
    atgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqsee
    gvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwak
    rsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdem
    frvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpi
    nirnarfsedlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqk
    irdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpqB (B:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatgadiilgntyhlmlrpgaer
    iaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldgsrhmlspersie
    iqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgiq
    qgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmgv
    gkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechcav
    cqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfraryf
    arns