PDB entry 5lpk

View 5lpk on RCSB PDB site
Description: Crystal structure of the bromodomain of human EP300 bound to the inhibitor XDM1
Class: transcription
Keywords: bromodomain, protein-inhibitor complex, epigenetics, transcription
Deposited on 2016-08-13, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpka_
  • Chain 'B':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpkb_
  • Chain 'C':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpkc_
  • Chain 'D':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpkd_
  • Chain 'E':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpke_
  • Chain 'F':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpkf_
  • Chain 'G':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpkg_
  • Heterogens: XDM, SO4, EDO, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lpkA (A:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkA (A:)
    kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
    ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lpkB (B:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkB (B:)
    fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkldt
    gqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lpkC (C:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkC (C:)
    ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
    tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5lpkD (D:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkD (D:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkl
    dtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5lpkE (E:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkE (E:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkl
    dtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lpkF (F:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkF (F:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkl
    dtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5lpkG (G:)
    apgqskkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdl
    stikrkldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqs
    lg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpkG (G:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkl
    dtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqsl