PDB entry 5lpf

View 5lpf on RCSB PDB site
Description: Kallikrein-related peptidase 10
Class: hydrolase
Keywords: Serine protease, zymogen-like enzyme, Zn2+ inhibition, tumor suppressor, hydrolase
Deposited on 2016-08-12, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-10
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK10, NES1, PRSSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpfa_
  • Chain 'B':
    Compound: Kallikrein-10
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK10, NES1, PRSSL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lpfb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lpfA (A:)
    ldpeaygspcargsqpwqvslfnglsfhcagvlvdqswvltaahcgnkplwarvgddhll
    llqgeqlrrttrsvvhpkyhqgsgpilprrtdehdlmllklarpvvlgprvralqlpyrc
    aqpgdqcqvagwgttaarrvkynkgltcssitilspkecevfypgvvtnnmicagldrgq
    dpcqsdsggplvcdetlqgilswgvypcgsaqhpavytqickymswinkvirsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpfA (A:)
    pcargsqpwqvslfnglsfhcagvlvdqswvltaahcgnkplwarvgdqgeqlrrttrsv
    vhpkytdehdlmllklarpvvlgprvralqlpyrcaqpgdqcqvagwgttankgltcssi
    tilspkecevfypgvvtnnmicagldrgqdpcqsdsggplvcdetlqgilswgvypcgsa
    qhpavytqickymswinkvirsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5lpfB (B:)
    ldpeaygspcargsqpwqvslfnglsfhcagvlvdqswvltaahcgnkplwarvgddhll
    llqgeqlrrttrsvvhpkyhqgsgpilprrtdehdlmllklarpvvlgprvralqlpyrc
    aqpgdqcqvagwgttaarrvkynkgltcssitilspkecevfypgvvtnnmicagldrgq
    dpcqsdsggplvcdetlqgilswgvypcgsaqhpavytqickymswinkvirsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpfB (B:)
    spcargsqpwqvslfnglsfhcagvlvdqswvltaahcgnkplwarvgdgeqlrrttrsv
    vhpkyhqrtdehdlmllklarpvvlgprvralqlpyrcaqpgdqcqvagwgttltcssit
    ilspkecevfypgvvtnnmicagldrgqdpcqsdsggplvcdetlqgilswgvypcgsaq
    hpavytqickymswinkvirsn