PDB entry 5lpb

View 5lpb on RCSB PDB site
Description: Crystal structure of the BRI1 kinase domain (865-1160) in complex with ADP from Arabidopsis thaliana
Class: transferase
Keywords: brassinosteroid receptor, kinase domain, dual-specificify kinase, membrane receptor kinase, plasma membrane, transferase
Deposited on 2016-08-12, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein BRASSINOSTEROID INSENSITIVE 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BRI1, At4g39400, F23K16.30
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22476 (Start-295)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d5lpba_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5lpbA (A:)
    ekplrklafadllqatngfhndsligsggfgdvykailkdgsavaikklihvsgqgdref
    maemetigkikhrnlvpllgyckvgderllvyefmkygsledvlhdpkkagvklnwstrr
    kiaigsarglaflhhncsphiihrdmkssnvlldenlearvsdfgmarlmsamdthlsvs
    tlagtpgyvppeyyqsfrcstkgdvysygvvllelltgkrptdspdfgdnnlvgwvkqha
    klrisdvfdpelmkedpaleiellqhlkvavaclddrawrrptmvqvmamfkeiqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lpbA (A:)
    plrklafadllqatngfhndsligsggfgdvykailkdgsavaikklihvsgqgdrefma
    emetigkikhrnlvpllgyckvgderllvyefmkygsledvlhdpgvklnwstrrkiaig
    sarglaflhhncsphiihrdmkssnvlldenlearvsdfgmarlmsamdthlsvstlagt
    pgyvppeyyqsfrcstkgdvysygvvllelltgkrptdnlvgwvkqhaklrisdvfdpel
    mkedpaleiellqhlkvavaclddrawrrptmvqvmamfkeiqa